Home
Products
Primary Antibodies
CAMP Polyclonal antibody, PBS Only (12009-1-PBS)

Filter: AllWBIHCIF-PIF/ICC

WB analysis using 12009-1-AP (same clone as 12009-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 12009-1-AP (CAMP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12009-1-AP (CAMP Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12009-1-AP (CAMP Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 12009-1-AP (same clone as 12009-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IF Staining of mouse liver using 12009-1-AP (same clone as 12009-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CAMP antibody (12009-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IF Staining of rat liver using 12009-1-AP (same clone as 12009-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using CAMP antibody (12009-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 12009-1-AP (same clone as 12009-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CAMP antibody (12009-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.
IF Staining of THP-1 using 12009-1-AP (same clone as 12009-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using CAMP antibody (12009-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12009-1-PBS in a different storage buffer formulation.

CAMP Polyclonal antibody, PBS Only

Name: CAMP Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 12009-1-PBS

CAMP Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 12009-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

CAP18, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20, Antibacterial peptide KS-30

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12009-1-PBS targets CAMP in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2622 Product name: Recombinant human CAMP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC055089 Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Predict reactive species
Full Name	cathelicidin antimicrobial peptide
Calculated Molecular Weight	170 aa, 19 kDa
Observed Molecular Weight	18 kDa
GenBank Accession Number	BC055089
Gene Symbol	CAMP
Gene ID (NCBI)	820
RRID	AB_908736
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P49913
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.