CAMP Recombinant monoclonal antibody

• 

  FC experiment of MCF-7 using 82940-2-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug Anti-Human CAMP (82940-2-RR, Clone:230157C6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  FC experiment of Hela using 82940-2-RR

  (blue)1x10^6 Hela cells were intracellularly stained with 0.25 ug Anti-Human CAMP (82940-2-RR, Clone:230157C6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution (red), or 0.25 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 82940-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82940-2-RR against Human CAMP were performed. The affinity constant is 1.50 nM.

CAMP Uni-rAb^® Recombinant Antibody for FC (Intra), ELISA

Cat No. 82940-2-RR

Clone No.230157C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

Synonyms

CAP18, Antibacterial peptide LL-23, Antibacterial peptide KS-30, Antibacterial peptide KR-20, Antibacterial peptide FF-33

---

Tested Applications

• Positive FC (Intra) detected in: MCF-7 cells, Hela cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82940-2-RR targets CAMP in FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2622

  Product name: Recombinant human CAMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC055089

  Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Full Name: cathelicidin antimicrobial peptide
• Calculated Molecular Weight: 170 aa, 19 kDa
• GenBank Accession Number: BC055089
• Gene Symbol: CAMP
• Gene ID (NCBI): 820
• RRID: AB_3670683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49913
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.