CAMP Recombinant monoclonal antibody

CAMP Uni-rAb® Recombinant Antibody for FC (Intra), ELISA
Cat No. 82940-2-RR
Clone No.230157C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

CAP18, Antibacterial peptide LL-23, Antibacterial peptide KS-30, Antibacterial peptide KR-20, Antibacterial peptide FF-33

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMCF-7 cells, Hela cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82940-2-RR targets CAMP in FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2622

Product name: Recombinant human CAMP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-170 aa of BC055089

Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Predict reactive species
Full Name cathelicidin antimicrobial peptide
Calculated Molecular Weight 170 aa, 19 kDa
GenBank Accession NumberBC055089
Gene Symbol CAMP
Gene ID (NCBI) 820
RRIDAB_3670683
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49913
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.

Loading...
||
New chat Able
正在加载,请稍候...