CoraLite® Plus 750-conjugated CAMP Recombinant monoclonal antibody

CAMP Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-82940
Clone No.230157B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB

CAP18, 230157B4, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman saliva

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82940 targets CAMP in WB applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2622

Product name: Recombinant human CAMP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-170 aa of BC055089

Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Predict reactive species
Full Name cathelicidin antimicrobial peptide
Calculated Molecular Weight 170 aa, 19 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC055089
Gene Symbol CAMP
Gene ID (NCBI) 820
RRIDAB_3673748
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49913
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 CAMP antibody CL750-82940Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...