CAPN5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CAPN5 Polyclonal antibody, PBS Only (29809-1-PBS)

• 

  WB analysis using 29809-1-AP (same clone as 29809-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29809-1-AP (CAPN5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29809-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29809-1-AP (same clone as 29809-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29809-1-AP (CAPN5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29809-1-PBS in a different storage buffer formulation.

CAPN5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29809-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29809-1-PBS targets CAPN5 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30479

  Product name: Recombinant human CAPN5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-105 aa of BC018123

  Sequence: MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWK

• Full Name: calpain 5
• Calculated Molecular Weight: 640 aa, 73 kDa
• Observed Molecular Weight: 65-73 kDa
• GenBank Accession Number: BC018123
• Gene Symbol: CAPN5
• Gene ID (NCBI): 726
• RRID: AB_3086169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15484
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calpain-5 is a protein that in humans is encoded by the CAPN5 gene. Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called HTRA3.