CAPZB Polyclonal antibody

• 

  WB analysis using 25043-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25043-1-AP (CAPZB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25043-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25043-1-AP (CAPZB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25043-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25043-1-AP (CAPZB Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 25043-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 25043-1-AP (CAPZB antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 25043-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CAPZB antibody (25043-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

CAPZB Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25043-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

F-actin-capping protein subunit beta, CapZbeta, CapZ beta

---

Tested Applications

• Positive WB detected in: A431 cells, mouse testis tissue, HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

25043-1-AP targets CAPZB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19327

  Product name: Recombinant human CAPZB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-243 aa of BC109241

  Sequence: SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL

• Full Name: capping protein (actin filament) muscle Z-line, beta
• Calculated Molecular Weight: 277 aa, 31 kDa
• Observed Molecular Weight: 30-31 kDa
• GenBank Accession Number: BC109241
• Gene Symbol: CAPZB
• Gene ID (NCBI): 832
• RRID: AB_2879867
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47756
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Nanoscale Architecture of the Cortical Actin Cytoskeleton in Embryonic Stem Cells.; Authors - Shumin Xia ; KD Validated
human	WB,IP	Elife; Capping protein regulates endosomal trafficking by controlling F-actin density around endocytic vesicles and recruiting RAB5 effectors.; Authors - Dawei Wang ; KD Validated
mouse	WB	Development; Loss of perinuclear theca ACTRT1 causes acrosome detachment and severe male subfertility in mice.; Authors - Xiao-Zhen Zhang
human,mouse	CoIP	Cell Rep; The perinuclear theca protein Calicin helps shape the sperm head and maintain the nuclear structure in mice.; Authors - Xiao-Zhen Zhang
human	WB	Cell Rep; Substrate rigidity dictates colorectal tumorigenic cell stemness and metastasis via CRAD-dependent mechanotransduction.; Authors - Yuhan Chang
human	WB	BMC Biol; The temporal association of CapZ with early endosomes regulates endosomal trafficking and viral entry into host cells; Authors - Huazhang Zhu