CARS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CARS2 Polyclonal antibody, PBS Only (33597-1-PBS)

• 

  WB analysis of SK-BR-3 using 33597-1-AP (same clone as 33597-1-PBS)

  WB result of CARS2 antibody (33597-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CARS2 transfected SK-BR-3 cells. This data was developed using the same antibody clone with 33597-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SK-BR-3 using 33597-1-AP (same clone as 33597-1-PBS)

  IP result of anti-CARS2 (IP:33597-1-AP, 4ug; Detection:33597-1-AP 1:3000) with SK-BR-3 cells lysate 1600 ug. This data was developed using the same antibody clone with 33597-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 33597-1-AP (same clone as 33597-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CARS2 antibody (33597-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 33597-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CARS2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 33597-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

CysRS, Cysteinyl-tRNA synthetase, EC:6.1.1.16, OK/SW-cl.10, Probable cysteine--tRNA ligase, mitochondrial

---

Product Information

33597-1-PBS targets CARS2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38943

  Product name: Recombinant human CARS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-564 aa of NM_024537.3

  Sequence: FLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG

• Full Name: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
• Calculated Molecular Weight: 62kDa，564aa
• Observed Molecular Weight: 55-63kd
• GenBank Accession Number: NM_024537.3
• Gene Symbol: CARS2
• Gene ID (NCBI): 79587
• RRID: AB_3743024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HA77
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cars2 (mitochondrial cysteine-tRNA synthetase 2) is a class I aminoacyl-tRNA synthetase encoded by nuclear gene, which locates in mitochondria. Its core function is to catalyze cysteine to bind to corresponding trna, and ensure the translation of mitochondrial protein. Its mutation will cause diseases related to mitochondrial dysfunction.