CASD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CASD1 Polyclonal antibody, PBS Only (34104-1-PBS)

• 

  IP experiment of LNCaP using 34104-1-AP (same clone as 34104-1-PBS)

  IP result of anti-CASD1 (IP:34104-1-AP, 4ug; Detection:34104-1-AP 1:300) with LNCaP cells lysate 1280 ug. This data was developed using the same antibody clone with 34104-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 34104-1-AP (same clone as 34104-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 34104-1-AP (CASD1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34104-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 34104-1-AP (same clone as 34104-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 34104-1-AP (CASD1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34104-1-PBS in a different storage buffer formulation.

CASD1 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 34104-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, Indirect ELISA

Synonyms

C7orf12, CAS1 Domain Containing 1, CAS1 Domain Sialic Acid O Acetyltransferase 1, CAS1 domain-containing protein 1, EC:2.3.1.45

---

Product Information

34104-1-PBS targets CASD1 in IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41108

  Product name: Recombinant human CASD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-227 aa of BC063284

  Sequence: PQFKEEGNKHENIPFEDKTASVKVDFLWHPEVNGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNE

• Full Name: CAS1 domain containing 1
• Observed Molecular Weight: 92 kDa
• GenBank Accession Number: BC063284
• Gene Symbol: CASD1
• Gene ID (NCBI): 64921
• RRID: AB_3743153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96PB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CASD1 (CAS1 domain-containing 1) is a multi-pass transmembrane protein localized in the trans-Golgi network. It contains an N-terminal SGNH hydrolase domain and a C-terminal region with 15 transmembrane segments. CASD1 catalyzes the O-acetylation of the C9 position of CMP-sialic acid, generating the 9-O-acetylated CMP-sialic acid donor, which is subsequently used for the synthesis of O-acetylated gangliosides (e.g., 9-O-AcGD3). This modification shields sialic acid from recognition by viral receptors, participates in host-pathogen interactions, and regulates the pro-apoptotic activity of GD3. (PMID: 34208013)