CASZ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CASZ1 Polyclonal antibody, PBS Only (14534-1-PBS)

• 

  WB analysis using 14534-1-AP (same clone as 14534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14534-1-AP (CASZ1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14534-1-PBS in a different storage buffer formulation.

• 

  IP experiment of C2C12 using 14534-1-AP (same clone as 14534-1-PBS)

  IP result of anti-CASZ1 (IP:14534-1-AP, 4ug; Detection:14534-1-AP 1:1000) with C2C12 cells lysate 1200 ug. This data was developed using the same antibody clone with 14534-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HUVEC using 14534-1-AP (same clone as 14534-1-PBS)

  IP result of anti-CASZ1 (IP:14534-1-AP, 4ug; Detection:14534-1-AP 1:1000) with HUVEC cells lysate 1080 ug. This data was developed using the same antibody clone with 14534-1-PBS in a different storage buffer formulation.

CASZ1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 14534-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

CAS11, Castor-related protein, CST, Putative survival-related protein, SRG

---

Product Information

14534-1-PBS targets CASZ1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6035

  Product name: Recombinant human CASZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 818-1166 aa of BC051883

  Sequence: PSLLGAVSSGSAASATPDTPTLVASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQEK

• Full Name: castor zinc finger 1
• Calculated Molecular Weight: 190 kDa
• Observed Molecular Weight: 150 kDa, 250 kDa
• GenBank Accession Number: BC051883
• Gene Symbol: CASZ1
• Gene ID (NCBI): 54897
• RRID: AB_3669188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86V15
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein castor homolog 1 (CASZ1), also known as zinc finger protein 693 (ZNF693), belongs to the C2H2-type zinc finger protein family. CASZ1 is a transcription factor that is evolutionarily conserved and participates in multiple embryonic development and physiological processes. CASZ1 has been found to regulate aldosterone synthesis and repress the activation of aldosterone target genes, suggesting that it may participate in blood pressure regulation. CASZ1 is ubiquitously expressed in various embryonic tissues. Subcellularly, CASZ1 is usually localized in the cell nucleus, consistent with its role in transcription regulation (PMID: 37509718). CASZ1 has two isoforms namely CASZ1a (i.e., hcasz11, 190 kDa) and CASZ1b (i.e., hcasz5, 125 kDa). The observed molecular weights were 150 kDa and 250 kDa, respectively, consistent with descriptions in the literature (PMID: 32060262).