Product Information
26890-1-PBS targets CATSPER2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25283 Product name: Recombinant human CATSPER2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC064387 Sequence: MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLF Predict reactive species |
| Full Name | cation channel, sperm associated 2 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC064387 |
| Gene Symbol | CATSPER2 |
| Gene ID (NCBI) | 117155 |
| RRID | AB_3742203 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96P56 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cation channel sperm-associated protein 2 (CATSPER2) is a pore-forming subunit of the CatSper complex, a sperm-specific voltage-gated calcium channel, that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte (PMID: 21412338; 21412339).
