CATSPERB Polyclonal antibody

• 

  WB analysis of L02 using 26633-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 26633-1-AP (CATSPERB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 26633-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26633-1-AP (CATSPERB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CATSPERB Polyclonal Antibody for WB, ELISA

Cat No. 26633-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C14orf161, CatSper beta, CatSper(beta), CATSPERB

---

Tested Applications

• Positive WB detected in: L02 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26633-1-AP targets CATSPERB in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23393

  Product name: Recombinant human CATSPERB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 772-1116 aa of BC126214

  Sequence: LLEVTAEVTFDDTDSYVITISAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPSKFIPFEDWISGVHKDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINEDGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRVTVISGVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQLQGIHPWRTFQRWIRRNQEKFSSISLSELIHRSKSEE

• Full Name: cation channel, sperm-associated, beta
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC126214
• Gene Symbol: CATSPERB
• Gene ID (NCBI): 79820
• RRID: AB_2880582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7T0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CATSPERB, also named as C14orf161 and CatSper-beta, is involved in sperm cell hyperactivation via its association with CATSPER1. CATSPERB has two isoforms with MW 127 kDa and 72 kDa.