CATSPERE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CATSPERE Polyclonal antibody (32840-1-AP)

• 

  WB analysis using 32840-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32840-1-AP (CATSPERE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CATSPERE Polyclonal Antibody for WB, ELISA

Cat No. 32840-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C1orf101, Cation channel sperm-associated auxiliary subunit epsilon, CatSperepsilon, CatSper-epsilon

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32840-1-AP targets CATSPERE in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36791

  Product name: Recombinant human C1orf101 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-804 aa of BC032859

  Sequence: DKGEALTVWTQIVYPENTGLYVIVESYGPKILQESHEISFEAAFGYCTKTLTLTFYQNVDYERISDYFETQDKHTGLVLVQFRPSEYSKACPIAQKVFQIAVGCDDKKFIAIKGFSKKGCHHHDFSYVIEKSYLRHQPSKNLRVRYIWGEYGCPLRLDFTEKFQPVVQLFDDNGYVKDVEANFIVWEIHGRDDYSFNNTMAQSGC

• Full Name: chromosome 1 open reading frame 101
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC032859
• Gene Symbol: C1orf101
• Gene ID (NCBI): 257044
• RRID: AB_3742759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5SY80
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cation channel sperm-associated auxiliary subunit epsilon (CATSPERE) is a critical component of the CatSper calcium channel complex, essential for sperm function and male fertility. CATSPERE interacts with the pore-forming subunits and contributes to the stability and function of the entire CatSper complex (PMID: 39605618). This complex is crucial for sperm capacitation, which includes the development of hyperactivated motility and the acrosome reaction, necessary for successful fertilization (PMID: 17330112; 18508611; 29707693).