Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, MCF-7 cells |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21179-1-AP targets CBLL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15463 Product name: Recombinant human CBLL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC027460 Sequence: TDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMS Predict reactive species |
| Full Name | Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 |
| Calculated Molecular Weight | 491 aa, 55 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC027460 |
| Gene Symbol | CBLL1 |
| Gene ID (NCBI) | 79872 |
| RRID | AB_10732814 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q75N03 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cbl proto‐oncogene E3 ubiquitin protein ligase‐like 1, RNF188, Hakai (CBLL1) is an evolutionarily conserved E3 ubiquitin ligase containing a RING‐finger domain. CBLL1 contains a typical RING‐finger, short pTyr‐binding domain, and proline‐rich domain. CBLL1 expression is upregulated in human colon and gastric cancer tissues, and CBLL1 has been reported to induce anchorage‐dependent cell growth. CBLL1 immunostaining was observed in both the nuclei and cytoplasm of cancer cells. (PMID: 31124298, PMID: 31646569, PMID: 21191016)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CBLL1 antibody 21179-1-AP | Download protocol |
| IHC protocol for CBLL1 antibody 21179-1-AP | Download protocol |
| WB protocol for CBLL1 antibody 21179-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CBLL1 Polyclonal antibody (Cat# 21179-1-AP) has 12 citations spanning journals including Phytomedicine, Cell Signal, Mol Biol Cell, Endocrinology, Int J Mol Med, J Ginseng Res, Med Oncol, J Inflamm Res, Front Genet, Chem Biodivers, Biochem Genet, and bioRxiv. Research fields cover m6A RNA methylation, macrophage polarization, rheumatoid arthritis, lung and breast cancer, E-cadherin/cell adhesion, chronic kidney disease, uterine fibroids, osteoporosis, and endometriosis.
| Species | Application | Title |
|---|---|---|
Phytomedicine Chromones from Saposhnikovia divaricata modulate m(6)A RNA methylation-mediated macrophage polarization by targeting CBLL1 to ameliorate RA.
| ||
J Ginseng Res Ginsenoside Rh2 reduces m6A RNA methylation in cancer via the KIF26B-SRF positive feedback loop | ||
Med Oncol Celastrol inhibits the migration and invasion and enhances the anti-cancer effects of docetaxel in human triple-negative breast cancer cells
| ||
J Inflamm Res Machine Learning and Experimental Validation of m6A RNA Methylation Related Signatures for Risk Prediction, Diagnostic Biomarkers, and Immune Subtypes in Chronic Kidney Disease. |
Reviews
What customers say
The single review for this antibody reports a 5-star rating. The user tested it by Western Blot on U2OS cells at a 1:3000 dilution and described it as an excellent antibody for Cbll1 detection in human cells. Overall, the feedback is positive, highlighting strong performance for its intended target in a human cell line.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tsimafei (Verified Customer) (09-22-2025) | Excellent antibody for Cbll1 detection in human cells
 |
