CBLL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CBLL1 Polyclonal antibody, PBS Only (21179-1-PBS)

• 

  WB analysis using 21179-1-AP (same clone as 21179-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21179-1-AP (CBLL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21179-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21179-1-AP (same clone as 21179-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21179-1-AP (CBLL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21179-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 21179-1-AP (same clone as 21179-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21179-1-AP (CBLL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21179-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 21179-1-AP (same clone as 21179-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 21179-1-AP (CBLL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21179-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21179-1-AP (same clone as 21179-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CBLL1 antibody (21179-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21179-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CBLL1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21179-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21179-1-PBS targets CBLL1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15463

  Product name: Recombinant human CBLL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC027460

  Sequence: TDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMS

• Full Name: Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
• Calculated Molecular Weight: 491 aa, 55 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC027460
• Gene Symbol: CBLL1
• Gene ID (NCBI): 79872
• RRID: AB_10732814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q75N03
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cbl proto‐oncogene E3 ubiquitin protein ligase‐like 1, RNF188, Hakai (CBLL1) is an evolutionarily conserved E3 ubiquitin ligase containing a RING‐finger domain. CBLL1 contains a typical RING‐finger, short pTyr‐binding domain, and proline‐rich domain. CBLL1 expression is upregulated in human colon and gastric cancer tissues, and CBLL1 has been reported to induce anchorage‐dependent cell growth. CBLL1 immunostaining was observed in both the nuclei and cytoplasm of cancer cells. (PMID: 31124298, PMID: 31646569, PMID: 21191016)