CBLN1 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 18207-1-AP

  WB result of CBLN1 antibody (18207-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-CBLN1 transfected SH-SY5Y cells.

• 

  WB analysis using 18207-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18207-1-AP (CBLN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CBLN1 Polyclonal Antibody for WB, ELISA

Cat No. 18207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CBLN1, CER [des Ser1] cerebellin, Cerebellin 1, cerebellin 1 precursor, Precerebellin

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, U-87 MG cells, Neuro-2a cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18207-1-AP targets CBLN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12835

  Product name: Recombinant human CBLN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-193 aa of BC093692

  Sequence: RGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL

• Full Name: cerebellin 1 precursor
• Calculated Molecular Weight: 193 aa, 21 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC093692
• Gene Symbol: CBLN1
• Gene ID (NCBI): 869
• RRID: AB_3669294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23435
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CBLN1 (Cerebellin-1) is also named as Precerebellin. CBLN1 is a newly identified synaptic organizer belonging to the C1q family. Cbln1 was recently identified as the missing ligand for the orphan glutamate receptor δ2 (GluD2) (PMID: 21342763). In the cerebellum, Cbln1 is produced and secreted from granule cells and works as a strong synapse organizer between Purkinje cells and parallel fibers, the axons of the granule cells (PMID: 24607546). The glycosylation modification of CBLN1 resulted in a larger molecular weight.