CBS Monoclonal antibody, PBS Only

• 

  WB analysis using 67861-1-Ig (same clone as 67861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCI-H1299 using 67861-1-Ig (same clone as 67861-1-PBS)

  WB result of CBS antibody (67861-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CBS transfected NCI-H1299 cells. This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67861-1-Ig (same clone as 67861-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67861-1-Ig (same clone as 67861-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67861-1-Ig (same clone as 67861-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67861-1-Ig (CBS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67861-1-Ig (same clone as 67861-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67861-1-Ig (CBS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67861-1-Ig (same clone as 67861-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67861-1-Ig (CBS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67861-1-Ig (same clone as 67861-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CBS antibody (67861-1-Ig, Clone: 1E4F10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67861-1-Ig (same clone as 67861-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CBS antibody (67861-1-Ig, Clone: 1E4F10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67861-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CBS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67861-1-PBS

Clone No.1E4F10

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:4.2.1.22, Cystathionine beta-synthase, cystathionine beta synthase, Beta-thionase, Beta thionase

---

Product Information

67861-1-PBS targets CBS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7008

  Product name: Recombinant human CBS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 206-551 aa of BC000440

  Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

• Full Name: cystathionine-beta-synthase
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61-63 kDa
• GenBank Accession Number: BC000440
• Gene Symbol: CBS
• Gene ID (NCBI): 875
• RRID: AB_2918619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).