CCBL1 Polyclonal antibody

• 

  WB analysis using 30296-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30296-1-AP (CCBL1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 30296-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CCBL1 antibody (30296-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

CCBL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30296-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CCBL1/KAT1, GTK, KAT1, CCBL 1, Cysteine-S-conjugate beta-lyase

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, U-87 MG cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30296-1-AP targets CCBL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32316

  Product name: Recombinant human CCBL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-374 aa of BC033685

  Sequence: ATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP

• Full Name: cysteine conjugate-beta lyase, cytoplasmic
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC033685
• Gene Symbol: CCBL1
• Gene ID (NCBI): 883
• RRID: AB_2935538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16773
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCBL1 encodes kynurenine aminotransferase 1 (KAT1), a key enzyme involved in kynurenine pathway. CCBL1 catalyzes the production of kynurenic acid, a powerful endogenous excitatory amino acid receptor antagonist that is widely regarded as the potent neuroprotective agent.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		bioRxiv; Cell type-specific master metabolic regulators of Alzheimer's disease; Authors - Yunguang Qiu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (08-30-2024)

Works well in WB with mouse liver lysate. Background is clean. The signal is not very strong.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse liver

CCBL1 Antibody Western Blot validation (1:500 dilution) in Mouse liver (Cat no:30296-1-AP)