CCDC12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC12 Polyclonal antibody, PBS Only (25138-1-PBS)

• 

  WB analysis of HeLa using 25138-1-AP (same clone as 25138-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25138-1-AP (CCDC12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 25138-1-AP (same clone as 25138-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 25138-1-AP (CCDC12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25138-1-AP (same clone as 25138-1-PBS)

  IP result of anti-CCDC12 (IP:25138-1-AP, 4ug; Detection:25138-1-AP 1:600) with HeLa cells lysate 2560ug. This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 25138-1-AP (same clone as 25138-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25138-1-AP (CCDC12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 25138-1-AP (same clone as 25138-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25138-1-AP (CCDC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25138-1-AP (same clone as 25138-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CCDC12 antibody (25138-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 25138-1-PBS in a different storage buffer formulation.

CCDC12 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 25138-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

25138-1-PBS targets CCDC12 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18223

  Product name: Recombinant human CCDC12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC020830

  Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD

• Full Name: coiled-coil domain containing 12
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 18-25 kDa
• GenBank Accession Number: BC020830
• Gene Symbol: CCDC12
• Gene ID (NCBI): 151903
• RRID: AB_2879919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUD4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC12 is a 166aa protein with MW 18-25 kDa (with some modification).