CCDC153 Polyclonal antibody

• 

  WB analysis using 21390-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 21390-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 21390-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 21390-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 21390-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate hyperplasia using 21390-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 21390-1-AP (CCDC153 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 21390-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 21390-1-AP (CCDC153 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 21390-1-AP

  Immunofluorescent analysis of HepG2 cells, using CCDC153 antibody 21390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HeLa using 21390-1-AP

  Immunofluorescent analysis of Hela cells, using CCDC153 antibody 21390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

CCDC153 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21390-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Dynein regulatory complex subunit 12 homolog, Dynein regulatory complex protein 12, DRC12, Coiled-coil domain-containing protein 153

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, L02 cells, human brain tissue, HeLa cells
• Positive IHC detected in: human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21390-1-AP targets CCDC153 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16044

  Product name: Recombinant human CCDC153 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC101443

  Sequence: MSRQCHALQEDMQTHSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL

• Full Name: coiled-coil domain containing 153
• Calculated Molecular Weight: 210 aa, 24 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC101443
• Gene Symbol: CCDC153
• Gene ID (NCBI): 283152
• RRID: AB_10858621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q494R4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC153's properties have yet to be elucidated. However, research suggests that it may be a neuronal subtype marker (PMID: 28166221). It has a molecular weight of 24 KDa and is often observed on a Western blot as a dimer.