Home
Products
Primary Antibodies
CCDC153 Polyclonal antibody, PBS Only (21390-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 21390-1-AP (same clone as 21390-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 21390-1-AP (same clone as 21390-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 21390-1-AP (same clone as 21390-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
WB analysis of L02 using 21390-1-AP (same clone as 21390-1-PBS)
L02 cells were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 21390-1-AP (same clone as 21390-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 21390-1-AP (CCDC153 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
IHC staining of human prostate hyperplasia using 21390-1-AP (same clone as 21390-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 21390-1-AP (CCDC153 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
IHC staining of human prostate hyperplasia using 21390-1-AP (same clone as 21390-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 21390-1-AP (CCDC153 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 21390-1-AP (same clone as 21390-1-PBS)
Immunofluorescent analysis of HepG2 cells, using CCDC153 antibody 21390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 21390-1-AP (same clone as 21390-1-PBS)
Immunofluorescent analysis of Hela cells, using CCDC153 antibody 21390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 21390-1-PBS in a different storage buffer formulation.

CCDC153 Polyclonal antibody, PBS Only

Name: CCDC153 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21390-1-PBS

CCDC153 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21390-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21390-1-PBS targets CCDC153 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16044 Product name: Recombinant human CCDC153 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC101443 Sequence: MSRQCHALQEDMQTHSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL Predict reactive species
Full Name	coiled-coil domain containing 153
Calculated Molecular Weight	210 aa, 24 kDa
Observed Molecular Weight	45-48 kDa
GenBank Accession Number	BC101443
Gene Symbol	CCDC153
Gene ID (NCBI)	283152
RRID	AB_10858621
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q494R4
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CCDC153's properties have yet to be elucidated. However, research suggests that it may be a neuronal subtype marker (PMID: 28166221). It has a molecular weight of 24 KDa and is often observed on a Western blot as a dimer.