Product Information
31922-1-PBS targets CCDC167 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37080 Product name: Recombinant human C6orf129 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC108655 Sequence: MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKN Predict reactive species |
| Full Name | chromosome 6 open reading frame 129 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC108655 |
| Gene Symbol | C6orf129 |
| Gene ID (NCBI) | 154467 |
| RRID | AB_3670146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9P0B6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Coiled-coil domain (CCD) constituents are alpha-helix motifs expressed in different types of proteins, which can function in various biological processes, including cell proliferation, migration, and signal transduction (PMID: 9171830; 17428801). The coiled-coil domain containing 167 (CCDC167, also known as HSPC265 and C6orf129) is a membrane protein highly expressed in the lymph node. It is associated with immune function, which could be a therapeutic target for breast cancer and asthma (PMID: 33461170; 31821602).



