CCDC167 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC167 Polyclonal antibody, PBS Only (31922-1-PBS)

• 

  WB analysis using 31922-1-AP (same clone as 31922-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31922-1-AP (CCDC167 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31922-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 31922-1-AP (same clone as 31922-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CCDC167 antibody (31922-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31922-1-PBS in a different storage buffer formulation.

CCDC167 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31922-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Transmembrane And Coiled-Coil Domain-Containing Protein C6orf129, HSPC265, Coiled-coil domain-containing protein 167, Coiled-Coil Domain Containing 167, Chromosome 6 Open Reading Frame 129

---

Product Information

31922-1-PBS targets CCDC167 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37080

  Product name: Recombinant human C6orf129 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-77 aa of BC108655

  Sequence: MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKN

• Full Name: chromosome 6 open reading frame 129
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC108655
• Gene Symbol: C6orf129
• Gene ID (NCBI): 154467
• RRID: AB_3670146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P0B6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Coiled-coil domain (CCD) constituents are alpha-helix motifs expressed in different types of proteins, which can function in various biological processes, including cell proliferation, migration, and signal transduction (PMID: 9171830; 17428801). The coiled-coil domain containing 167 (CCDC167, also known as HSPC265 and C6orf129) is a membrane protein highly expressed in the lymph node. It is associated with immune function, which could be a therapeutic target for breast cancer and asthma (PMID: 33461170; 31821602).