CCDC23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC23 Polyclonal antibody, PBS Only (30688-1-PBS)

• 

  IHC staining of mouse skin using 30688-1-AP (same clone as 30688-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 30688-1-AP (CCDC23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30688-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 30688-1-AP (same clone as 30688-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 30688-1-AP (CCDC23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30688-1-PBS in a different storage buffer formulation.

CCDC23 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30688-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

SVBP, Coiled coil domain-containing protein 23, Small vasohibin-binding protein

---

Product Information

30688-1-PBS targets CCDC23 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33650

  Product name: Recombinant human CCDC23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-66 aa of BC029427

  Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

• Full Name: coiled-coil domain containing 23
• GenBank Accession Number: BC029427
• Gene Symbol: CCDC23
• Gene ID (NCBI): 374969
• RRID: AB_3742367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N300
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758).