CCDC25 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84484-3-RR (same clone as 84484-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84484-3-RR (CCDC25 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84484-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84484-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84484-3-RR against Human CCDC25 were performed. The affinity constant is 0.771 nM.

CCDC25 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84484-3-PBS

Clone No.241878H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

241878H5, Coiled-coil domain-containing protein 25

---

Product Information

84484-3-PBS targets CCDC25 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15593

  Product name: Recombinant human CCDC25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC032588

  Sequence: MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM

• Full Name: coiled-coil domain containing 25
• Calculated Molecular Weight: 208 aa, 24 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC032588
• Gene Symbol: CCDC25
• Gene ID (NCBI): 55246
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86WR0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.