CCDC25 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CCDC25 Recombinant monoclonal antibody (84484-3-RR)

CCDC25 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84484-3-RR Copied!

Clone No. 241878H5

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Coiled-coil domain-containing protein 25, 241878H5

• 

  WB analysis using 84484-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84484-3-RR (CCDC25 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84484-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84484-3-RR against Human CCDC25 were performed. The affinity constant is 0.771 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCDC25 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, A2780 cells, K-562 cells, MCF-7 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84484-3-RR targets CCDC25 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15593

  Product name: Recombinant human CCDC25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC032588

  Sequence: MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM

• Full Name: coiled-coil domain containing 25
• Calculated Molecular Weight: 208 aa, 24 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC032588
• Gene Symbol: CCDC25
• Gene ID (NCBI): 55246
• RRID: AB_3672001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86WR0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-CCDC25 recombinant antibody (Cat# 84484-3-RR) has 2 total citations. One appears in International Immunopharmacology, investigating neutrophil extracellular traps inducing hepatocyte pyroptosis via CCDC25 in sepsis-associated liver injury (WB application). The other is published in Nature Communications, exploring how neutrophil extracellular traps promote liver metastasis by impairing NK cell-dependent tumor surveillance via CCDC25. Both studies focus on the role of CCDC25 in liver pathology and tumor microenvironment regulation.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Int Immunopharmacol; Neutrophil extracellular traps induce hepatocyte pyroptosis via CCDC25 in sepsis-associated liver injury.; Authors - Zhiyu Li ; KD Validated
		Nat Commun; Neutrophil extracellular traps promote liver metastasis by impairing NK cell-dependent tumor surveillance via CCDC25.; Authors - Yetong Zhang