CCDC33 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC33 Polyclonal antibody, PBS Only (25822-1-PBS)

• 

  WB analysis using 25822-1-AP (same clone as 25822-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25822-1-AP (CCDC33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25822-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 25822-1-AP (same clone as 25822-1-PBS)

  IP result of anti-CCDC33 (IP:25822-1-AP, 4ug; Detection:25822-1-AP 1:600) with mouse testis tissue lysate 1800 ug. This data was developed using the same antibody clone with 25822-1-PBS in a different storage buffer formulation.

CCDC33 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25822-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Cancer/testis antigen 61, CT61

---

Product Information

25822-1-PBS targets CCDC33 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22893

  Product name: Recombinant human CCDC33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC025689

  Sequence: SEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQ

• Full Name: coiled-coil domain containing 33
• Calculated Molecular Weight: 958 aa, 107 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC025689
• Gene Symbol: CCDC33
• Gene ID (NCBI): 80125
• RRID: AB_3742161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5R6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human CCDC33 gene was reported to encode a cancer/testis (CT) antigen, which is located on 15q24.1, spans a region of 99.8 kb, and consists of 20 exons (PMID: 28639886). CCDC33 is predominantly expressed in the testis and undergoes alternative splicing to produce at least 5 different transcripts (37kda, 41kda, 85kda, 107kda, 114kda). Human CCDC33 was reported to be a cancer/testis (CT) protein. Abundant expression of Ccdc33 is evident during mouse spermatogenesis (PMID: 33942254).