CCDC64B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC64B Polyclonal antibody, PBS Only (22770-1-PBS)

• 

  WB analysis using 22770-1-AP (same clone as 22770-1-PBS)

  MCF-7 lysates were subjected to SDS PAGE followed by western blot with 22770-1-AP (CCDC64B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22770-1-AP (same clone as 22770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22770-1-AP (CCDC64B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22770-1-AP (same clone as 22770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22770-1-AP (CCDC64B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22770-1-PBS in a different storage buffer formulation.

CCDC64B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22770-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22770-1-PBS targets CCDC64B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18720

  Product name: Recombinant human CCDC64B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-508 aa of BC128602

  Sequence: LQSRRQDLEAQIRGLREEVEKGEGRLQTTHEELLLLRRERREHSLELERARSEAGEALSALRRLRRRVSELEEESRLQDADVSAASLQSELAHSLDDGDQGQGADAPGDTPTTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREELQRQKELRAQEDPGEALHSALSDRDEAVNKALELSLQLNRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQVVIGQQLRSQRQKELSASASSSTPRRAAPRFSLRLGPGPAGGFLSNLFRRT

• Full Name: coiled-coil domain containing 64B
• Calculated Molecular Weight: 508 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC128602
• Gene Symbol: CCDC64B
• Gene ID (NCBI): 146439
• RRID: AB_2918078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1A5D9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC64B, also named as BICDL2 and BICDR2, belongs to BICD family. It was officially named by Schlager et al (2010) in a sequence homology search for new mammalian BICD-like proteins. At present, there is still little study on this protein, which may involve the vesicle transport along microtubule, and Golgi to secretory granule transport. BICDR2 has 2 isoforms with the molecular mass of 57 and 34 kDa (PMID:20360680, 20485297).