CCDC72 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC72 Polyclonal antibody, PBS Only (20393-1-PBS)

• 

  WB analysis of A549 using 20393-1-AP (same clone as 20393-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20393-1-AP (same clone as 20393-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 20393-1-AP (same clone as 20393-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20393-1-AP (CCDC72 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 20393-1-AP (same clone as 20393-1-PBS)

  IP result of anti-CCDC72 (IP:20393-1-AP, 4ug; Detection:20393-1-AP 1:500) with A549 cells lysate 2400 ug. This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20393-1-AP (same clone as 20393-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20393-1-AP (same clone as 20393-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 20393-1-AP (same clone as 20393-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed A549 cells using 20393-1-AP (CCDC72 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20393-1-PBS in a different storage buffer formulation.

CCDC72 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

20393-1-PBS targets CCDC72 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13792

  Product name: Recombinant human CCDC72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC001102

  Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK

• Full Name: coiled-coil domain containing 72
• Calculated Molecular Weight: 64 kDa, 7 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC001102
• Gene Symbol: CCDC72
• Gene ID (NCBI): 51372
• RRID: AB_10667404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2S6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC72, also named as TMA7, is a novel modulator for hair follicle development. CCDC72 has the promoter activity and regulation of gene expression.