CCDC85B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCDC85B Polyclonal antibody, PBS Only (18282-1-PBS)

• 

  WB analysis of mouse heart using 18282-1-AP (same clone as 18282-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 18282-1-AP (CCDC85B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 18282-1-AP (same clone as 18282-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 18282-1-AP (CCDC85B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 18282-1-AP (same clone as 18282-1-PBS)

  IP result of anti-CCDC85B (IP:18282-1-AP, 4ug; Detection:18282-1-AP 1:300) with mouse heart tissue lysate 3600ug. This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18282-1-AP (same clone as 18282-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18282-1-AP (CCDC85B antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18282-1-AP (same clone as 18282-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18282-1-AP (CCDC85B antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 18282-1-AP (same clone as 18282-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 18282-1-AP (CCDC85B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18282-1-PBS in a different storage buffer formulation.

CCDC85B Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18282-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

18282-1-PBS targets CCDC85B in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13129

  Product name: Recombinant human CCDC85B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC008796

  Sequence: MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD

• Full Name: coiled-coil domain containing 85B
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC008796
• Gene Symbol: CCDC85B
• Gene ID (NCBI): 11007
• RRID: AB_2878527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15834
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Coiled-coil domain-containing protein 85B (CCDC85B), also named as DIPA, is 202 amino acid protein, which belongs to the CCDC85 family. CCDC85B localizes in the nucleus and cytoplasm. CCDC85B is widely expressed in many tissues and functions as a transcriptional repressor. CCDC85B may inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth. CCDC85B may play a role in adipocyte differentiation.