Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human CCL14 Rabbit Recombinant Antibody, PBS Only (98554-1-PBS)

Anti-Human CCL14 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human CCL14 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98554-1-PBS-1MG

CCL14 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98554-1-PBS

Clone No. 250487E9

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

C C motif chemokine 14, C-C motif chemokine 14, CCL-14, Chemokine CC-1/CC-3, HCC-1(1-74)

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of Transfected CHO using 98554-1-RR (same clone as 98554-1-PBS)
1x10^6 CHO cells or CCL14-transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human CCL14 Rabbit RecAb (98554-1-RR, Clone:250487E9) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98554-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Transfected CHO using 98554-1-RR (same clone as 98554-1-PBS)
1x10^6 CHO cells or CCL14-transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human CCL14 Rabbit RecAb (98554-1-RR, Clone:250487E9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98554-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 CHO cells or CCL14-transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human CCL14 Rabbit RecAb (98554-1-RR, Clone:250487E9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98554-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 98554-1-RR
Biolayer interferometry (BLl) kinetic assays of 98554-1-RR against Human CCL14 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL14 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98554-1-PBS targets CCL14 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2879 Product name: Recombinant Human CCL14 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-93 aa of NM_032963.3 Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Predict reactive species
Full Name	chemokine (C-C motif) ligand 14
Calculated Molecular Weight	11k kDa
GenBank Accession Number	NM_032963.3
Gene Symbol	CCL14
Gene ID (NCBI)	6358
RRID	AB_3746174
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q16627-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CCL14, also known as HCC-1, is a human plasma chemokine that belongs to the CC chemokine family. It was originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 is constitutively expressed in various tissues, including the spleen, bone marrow, liver, muscle, and intestine. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis (PMID: 31641099), and CCL14 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma (PMID: 39030403).