Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human CCL14 Rabbit Recombinant Antibody (98554-1-RR)

Anti-Human CCL14 Rabbit Recombinant Antibody

CCL14 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98554-1-RR

Clone No. 250487E9

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

C C motif chemokine 14, C-C motif chemokine 14, CCL-14, Chemokine CC-1/CC-3, HCC-1(1-74)

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of Transfected CHO using 98554-1-RR
1x10^6 CHO cells or CCL14-transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human CCL14 Rabbit RecAb (98554-1-RR, Clone:250487E9) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Transfected CHO using 98554-1-RR
1x10^6 CHO cells or CCL14-transfected CHO cells were intracellularly stained with 0.25 ug Anti-Human CCL14 Rabbit RecAb (98554-1-RR, Clone:250487E9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 98554-1-RR
Biolayer interferometry (BLl) kinetic assays of 98554-1-RR against Human CCL14 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL14 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC (Intra) detected in

Transfected CHO cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98554-1-RR targets CCL14 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2879 Product name: Recombinant Human CCL14 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-93 aa of NM_032963.3 Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Predict reactive species
Full Name	chemokine (C-C motif) ligand 14
Calculated Molecular Weight	11k kDa
GenBank Accession Number	NM_032963.3
Gene Symbol	CCL14
Gene ID (NCBI)	6358
RRID	AB_3746174
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q16627-1
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CCL14, also known as HCC-1, is a human plasma chemokine that belongs to the CC chemokine family. It was originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 is constitutively expressed in various tissues, including the spleen, bone marrow, liver, muscle, and intestine. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis (PMID: 31641099), and CCL14 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma (PMID: 39030403).