Mouse CCL17/TARC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86482-1-RR (same clone as 86482-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86482-1-RR (Ccl17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86482-1-PBS in a different storage buffer formulation.

CCL17/TARC Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86482-1-PBS

Clone No.250385G4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

ABCD-2, CC chemokine TARC, C-C motif chemokine 17, Ccl17, Small-inducible cytokine A17

---

Product Information

86482-1-PBS targets CCL17/TARC in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3319

  Product name: recombinant mouse Ccl17 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-93 aa of NM_011332.3

  Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

• Full Name: chemokine (C-C motif) ligand 17
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_011332.3
• Gene Symbol: Ccl17
• Gene ID (NCBI): 20295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: F6R5P4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.