CCL17/TARC Recombinant monoclonal antibody

• 

  WB analysis using 86482-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86482-1-RR (Ccl17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CCL17/TARC Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86482-1-RR

Clone No.250385G4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

ABCD-2, CC chemokine TARC, C-C motif chemokine 17, Ccl17, Small-inducible cytokine A17

---

Tested Applications

• Positive WB detected in: NR8383 cells, MH-S cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86482-1-RR targets CCL17/TARC in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3319

  Product name: recombinant mouse Ccl17 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-93 aa of NM_011332.3

  Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

• Full Name: chemokine (C-C motif) ligand 17
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_011332.3
• Gene Symbol: Ccl17
• Gene ID (NCBI): 20295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: F6R5P4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.