Anti-Rat CCL20/MIP-3 alpha Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat CCL20/MIP-3 alpha Rabbit Recombinant Antibody (98500-1-RR)

CCL20/MIP-3 alpha Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98500-1-RR Copied!

Clone No. 250116G4

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

Beta-chemokine exodus-1, CC chemokine LARC, CC chemokine ST38, C-C motif chemokine 20, CCL 20

• 

  FC experiment of Transfected HEK-293T using 98500-1-RR

  1x10^6 HEK-293T cells or CCL20/MIP-3 alpha transfected HEK-293T cells were stained with 0.25 ug Anti-Rat CCL20/MIP-3 alpha Rabbit RecAb (98500-1-RR, Clone: 250116G4) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98500-1-RR

  1x10^6 HEK-293T cells or CCL20/MIP-3 alpha transfected HEK-293T cells were stained with 0.25 ug Anti-Rat CCL20/MIP-3 alpha Rabbit RecAb (98500-1-RR, Clone: 250116G4) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL20/MIP-3 alpha in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98500-1-RR targets CCL20/MIP-3 alpha in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3237

  Product name: Recombinant Rat CCL20/MIP-3 alpha protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-96 aa of NM_019233.1

  Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM

• Full Name: chemokine (C-C motif) ligand 20
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NM_019233.1
• Gene Symbol: Ccl20
• Gene ID (NCBI): 29538
• RRID: AB_3746130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P97884
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.