FcZero-rAb® CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit Recombinant Antibody

Name: FcZero-rAb® CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit Recombinant Antibody, 100tests
Brand: Proteintech
SKU: CL647-FCA98221-100TESTS

CCL20/MIP-3 alpha FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. CL647-FcA98221

Clone No.241694B2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CCL20, MIP-3 Alpha, MIP-3α, Beta-chemokine exodus-1, C C motif chemokine 20

Formulation: PBS, Azide, BSA

PBS, Azide, BSA

Conjugate: CoraLite® Plus 647

Biotin CoraLite® Plus 488 CoraLite® Plus 647 PE

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of THP-1 using CL647-FcA98221
1x10^6 untreated or PMA, LPS and Brefeldin A treated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2). Cells were incubated with MonoZero™ Human Fc Blocking Reagent (PF00032) prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 untreated or PMA, LPS and Brefeldin A treated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2). Cells were incubated with MonoZero™ Human Fc Blocking Reagent (PF00032) prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
FC experiment of THP-1 using CL647-FcA98221
1x10^6 PMA, LPS and Brefeldin A treated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2) (red) or FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2) (black, dashed). Cells were incubated with MonoZero™ Human Fc Blocking Reagent (PF00032) prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 PMA, LPS and Brefeldin A treated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2) (red) or FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated THP-1 cells were intracellularly stained with 5 ul CoraLite® Plus 647 Anti-Human CCL20/MIP-3 alpha Rabbit RecAb (CL647-FcA98221, Clone: 241694B2) (black, dashed). Cells were incubated with MonoZero™ Human Fc Blocking Reagent (PF00032) prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC (Intra) detected in

PMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98221 targets CCL20/MIP-3 alpha in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2398 Product name: Recombinant Human CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-96 aa of NM_004591.3 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species
Full Name	chemokine (C-C motif) ligand 20
Calculated Molecular Weight	11kDa
GenBank Accession Number	NM_004591.3
Gene Symbol	CCL20/MIP-3 alpha
Gene ID (NCBI)	6364
Conjugate	CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths	654 nm / 674 nm
Excitation Laser	Red Laser (633 nm)
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P78556-1
Storage Buffer	PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage Conditions	Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CCL20, also known as macrophage inﬁltrating factor protein 3α, is a C-C chemokine that speciﬁcally binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.