Product Information
86287-3-PBS targets CCL24/Eotaxin 2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0395 Product name: Recombinant Human CCL24 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 27-119 aa of NM_002991 Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 24 |
| Calculated Molecular Weight | 13kd |
| GenBank Accession Number | NM_002991 |
| Gene Symbol | CCL24/Eotaxin 2 |
| Gene ID (NCBI) | 6369 |
| RRID | AB_3744784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00175 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Chemokine CCL24 is the second member of eotaxins, a group of eosinophils' selectively chemoattractants. CCL24 is constitutively expressed in fibroblasts, epithelial cells, macrophages. CCL24 has only one receptor CCR3, which mainly presents on eosinophils and was also found on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscles. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes.
