CCL24/Eotaxin 2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CCL24/Eotaxin 2 Recombinant monoclonal antibody (86287-3-RR)

• 

  WB analysis of Recombinant protein using 86287-3-RR

  Human CCL24 recombinant protein was subjected to SDS PAGE followed by western blot with 86287-3-RR (CCL24 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CCL24/Eotaxin 2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86287-3-RR

Clone No.243063B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CCL24, Eotaxin 2, C C motif chemokine 24, C-C motif chemokine 24, CCL 24

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86287-3-RR targets CCL24/Eotaxin 2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0395

  Product name: Recombinant Human CCL24 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 27-119 aa of NM_002991

  Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

• Full Name: chemokine (C-C motif) ligand 24
• Calculated Molecular Weight: 13kd
• GenBank Accession Number: NM_002991
• Gene Symbol: CCL24/Eotaxin 2
• Gene ID (NCBI): 6369
• RRID: AB_3744784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00175
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chemokine CCL24 is the second member of eotaxins, a group of eosinophils' selectively chemoattractants. CCL24 is constitutively expressed in fibroblasts, epithelial cells, macrophages. CCL24 has only one receptor CCR3, which mainly presents on eosinophils and was also found on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscles. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes.