Product Information
87376-1-PBS targets CCL4L1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5335 Product name: Recombinant Human CCL4L1 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of N/A Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 4-like 1 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | N/A |
| Gene Symbol | CCL4L1 |
| Gene ID (NCBI) | 9560 |
| RRID | AB_3745495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8NHW4-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CCL4L1 encodes a secreted chemokine ligand in the intercrine beta family that functions in inflammatory and immunoregulatory processes. The encoded 92-amino-acid protein is similar to chemokine (C-C motif) ligand 4, and the gene belongs to a cluster of cytokine genes on the q-arm of chromosome 17. CCL4L1 is localized to the extracellular region, placing it in a position to act in intercellular signaling.





