Anti-Mouse CCL6/C10 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CCL6/C10 Rabbit Recombinant Antibody, PBS Only (98482-3-PBS)

CCL6/C10 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98482-3-PBS Copied!

Clone No. 250240F6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

C10, C-C motif chemokine 6, Ccl6, CCL6(22-95), CCL6(23-95)

• 

  FC experiment of Transfected HEK-293T using 98482-3-RR (same clone as 98482-3-PBS)

  1x10^6 HEK-293T cells or CCL6 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL6 Rabbit RecAb (98482-3-RR, Clone: 250240F6) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98482-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98482-3-RR (same clone as 98482-3-PBS)

  1x10^6 HEK-293T cells or CCL6 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse Ccl6 Rabbit RecAb (98482-3-RR, Clone: 250240F6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98482-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL6/C10 in ?

Chat with Able

---

Product Information

98482-3-PBS targets CCL6/C10 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2957

  Product name: Recombinant Mouse CCL6 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-116 aa of NM_009139.3

  Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

• Full Name: chemokine (C-C motif) ligand 6
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: NM_009139.3
• Gene Symbol: Ccl6
• Gene ID (NCBI): 20305
• RRID: AB_3746112
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27784
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.