Tested Applications
| Positive FC (Intra) detected in | Transfected HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98482-3-RR targets CCL6/C10 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2957 Product name: Recombinant Mouse CCL6 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-116 aa of NM_009139.3 Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 6 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | NM_009139.3 |
| Gene Symbol | Ccl6 |
| Gene ID (NCBI) | 20305 |
| RRID | AB_3746112 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P27784 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CCL6/C10 antibody 98482-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
Both reviews (2 total) are for Western Blot at a 1:1000 dilution on mouse intestinal tissue, using different lots. Each reviewer rated the product 1 out of 5 stars and reported that the antibody did not work for WB, suggesting it might be more suitable for flow cytometry instead. Overall, the feedback is negative for the WB application, with no successful results reported.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jagannatham Naidu (Verified Customer) (10-02-2025) | it doesn't work for WB, MAYBE IT CAN WORK FOR FLOW
|
Jagannatham Naidu (Verified Customer) (10-02-2025) | it doesn't work for WB, MAYBE IT CAN WORK FOR FLOW
|
