Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody, PBS Only (98555-1-PBS)

Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98555-1-PBS-1MG

CCL7/MCP-3 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98555-1-PBS

Clone No. 250662G6

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

C-C motif chemokine 7, Ccl7, Fic, Intercrine/chemokine MARC, Mcp3

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of Transfected HEK-293T using 98555-1-RR (same clone as 98555-1-PBS)
1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone: 250662G6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98555-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone: 250662G6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98555-1-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98555-1-RR (same clone as 98555-1-PBS)
1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone:250662G6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98555-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone:250662G6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98555-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 98555-1-RR
Biolayer interferometry (BLl) kinetic assays of 98555-1-RR against Mouse CCL7/MCP-3 were performed. The affinity constant is 0.524 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL7/MCP-3 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98555-1-PBS targets CCL7/MCP-3 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg4626 Product name: Recombinant Mouse CCL7/MCP-3 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_013654.3 Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP Predict reactive species
Full Name	chemokine (C-C motif) ligand 7
Calculated Molecular Weight	11kDa
GenBank Accession Number	NM_013654.3
Gene Symbol	Ccl7
Gene ID (NCBI)	20306
RRID	AB_3746175
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q03366
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The chemokine CCL7 (MCP3) is a chemotactic factor and potent attractant of monocytes firstly characterized from the culture supernatants of MG-63 osteosarcoma cells. CCL7 is known to promote the recruitment of many innate immune cell types including monocytes and neutrophils to sites of bacterial and viral infection and eosinophils and basophils to sites of allergic inflammation. CCL7 is expressed at low levels in endothelial cells, fibroblasts and mononuclear cells and upregulated by various stimuli including viruses, type I or type II interferons (IFNs). CCL7 (MCP-3) mediates effects on a host of innate and adaptive immune cell types through binding to numerous receptors including CCR1, CCR2, CCR3, CCR5, and CCR10.