Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody (98555-1-RR)

CCL7/MCP-3 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98555-1-RR Copied!

Clone No. 250662G6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

C-C motif chemokine 7, Ccl7, Fic, Intercrine/chemokine MARC, Mcp3

• 

  FC experiment of Transfected HEK-293T using 98555-1-RR

  1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone: 250662G6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98555-1-RR

  1x10^6 HEK-293T cells or CCL7/MCP-3 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL7/MCP-3 Rabbit RecAb (98555-1-RR, Clone:250662G6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98555-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98555-1-RR against Mouse CCL7/MCP-3 were performed. The affinity constant is 0.524 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL7/MCP-3 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98555-1-RR targets CCL7/MCP-3 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4626

  Product name: Recombinant Mouse CCL7/MCP-3 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 24-97 aa of NM_013654.3

  Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

• Full Name: chemokine (C-C motif) ligand 7
• Calculated Molecular Weight: 11kDa
• GenBank Accession Number: NM_013654.3
• Gene Symbol: Ccl7
• Gene ID (NCBI): 20306
• RRID: AB_3746175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03366
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The chemokine CCL7 (MCP3) is a chemotactic factor and potent attractant of monocytes firstly characterized from the culture supernatants of MG-63 osteosarcoma cells. CCL7 is known to promote the recruitment of many innate immune cell types including monocytes and neutrophils to sites of bacterial and viral infection and eosinophils and basophils to sites of allergic inflammation. CCL7 is expressed at low levels in endothelial cells, fibroblasts and mononuclear cells and upregulated by various stimuli including viruses, type I or type II interferons (IFNs). CCL7 (MCP-3) mediates effects on a host of innate and adaptive immune cell types through binding to numerous receptors including CCR1, CCR2, CCR3, CCR5, and CCR10.