Cyclin B1 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Cyclin B1 Recombinant monoclonal antibody, PBS Only (Detector) (85895-1-PBS)

Cyclin B1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85895-1-PBS

Clone No.250227H1

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

CCNB1, CCNB, Cyclin B, G2/mitotic specific cyclin B1, G2/mitotic-specific cyclin-B1

• 

  WB analysis using 85895-1-RR (same clone as 85895-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85895-1-RR (Cyclin B1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85895-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP02202-2

  The mean Cyclin B1 concentration was determined to be 21.36 ng/mL in K-562 cell extract based on a 2.50 mg/mL extract load and 9.28 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02202-2

  Sandwich ELISA standard curve of MP02202-2, Human Cyclin B1 Recombinant Matched Antibody Pair - PBS only. 85895-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag29426. 85895-1-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP02202-1

  The mean Cyclin B1 concentration was determined to be 33.7 ng/mL in Hela cell extract based on a 1.3 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP02202-1

  Cytometric bead array standard curve of MP02202-1, Cyclin B1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85895-2-PBS. Detection antibody: 85895-1-PBS. Standard: Ag29426. Range: 1.563-100 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 85895-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85895-1-RR against Human Cyclin B1 were performed. The affinity constant is 3.29 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

85895-1-PBS targets Cyclin B1 as part of a matched antibody pair:

MP02202-1: 85895-2-PBS capture and 85895-1-PBS detection (validated in Cytometric bead array)

MP02202-2: 85895-4-PBS capture and 85895-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29426

  Product name: Recombinant human CCNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC006510

  Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE

• Full Name: cyclin B1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC006510
• Gene Symbol: Cyclin B1
• Gene ID (NCBI): 891
• RRID: AB_3744453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14635
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.