CCNY Monoclonal antibody

• 

  WB analysis using 66865-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 66865-1-Ig

  WB result of CCNY antibody (66865-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CCNY transfected A549 cells.

• 

  WB analysis of RAW 264.7 using 66865-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66865-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CCNY Monoclonal Antibody for WB, ELISA

Cat No. 66865-1-Ig

Clone No.2C9E3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

C10orf9, CBCP1, CCNY, CFP1, Cyc Y, Cyclin box protein 1, Cyclin fold protein 1, cyclin X, cyclin Y, FLJ95513

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, RAW 264.7 cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

66865-1-Ig targets CCNY in WB, IF, ELISA applications and shows reactivity with Human, Rat, Mouse samples.

• Tested Reactivity: Human, Rat, Mouse
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12691

  Product name: Recombinant human CCNY protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-287 aa of BC104773

  Sequence: MEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

• Full Name: cyclin Y
• Calculated Molecular Weight: 33 kDa, 39 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC104773
• Gene Symbol: CCNY
• Gene ID (NCBI): 219771
• RRID: AB_2882202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8ND76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCNY, also named as C10orf9, CBCP1, CFP1, is a novel cyclin. CCNY acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; AMPK-dependent activation of the Cyclin Y/CDK16 complex controls autophagy.; Authors - Marc Dohmen