CCNY Monoclonal antibody, PBS Only

• 

  WB analysis using 66865-1-Ig (same clone as 66865-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66865-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66865-1-Ig (same clone as 66865-1-PBS)

  WB result of CCNY antibody (66865-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CCNY transfected A549 cells. This data was developed using the same antibody clone with 66865-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66865-1-Ig (same clone as 66865-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66865-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66865-1-Ig (same clone as 66865-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66865-1-Ig (CCNY antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66865-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CCNY Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66865-1-PBS

Clone No.2C9E3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Mouse

Applications

WB, Indirect ELISA

Synonyms

C10orf9, CBCP1, CCNY, CFP1, Cyc Y, Cyclin box protein 1, Cyclin fold protein 1, cyclin X, cyclin Y, FLJ95513

---

Product Information

66865-1-PBS targets CCNY in WB, Indirect ELISA applications and shows reactivity with Human, Rat, Mouse samples.

• Tested Reactivity: Human, Rat, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12691

  Product name: Recombinant human CCNY protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-287 aa of BC104773

  Sequence: MEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

• Full Name: cyclin Y
• Calculated Molecular Weight: 33 kDa, 39 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC104773
• Gene Symbol: CCNY
• Gene ID (NCBI): 219771
• RRID: AB_2882202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8ND76
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCNY, also named as C10orf9, CBCP1, CFP1, is a novel cyclin. CCNY acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway.