• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CCNY Monoclonal antibody

CCNY Monoclonal Antibody for
Cat No. CL488-66865
Clone No.2C9E3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Mouse

Applications

C10orf9, CBCP1, CCNY, CFP1, Cyc Y, Cyclin box protein 1, Cyclin fold protein 1, cyclin X, cyclin Y, FLJ95513

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66865 targets CCNY in applications and shows reactivity with Human, Rat, Mouse samples.

Tested Reactivity Human, Rat, Mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12691

Product name: Recombinant human CCNY protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-287 aa of BC104773

Sequence: MEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

Predict reactive species
Full Name cyclin Y
Calculated Molecular Weight 33 kDa, 39 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC104773
Gene Symbol CCNY
Gene ID (NCBI) 219771
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8ND76
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCNY, also named as C10orf9, CBCP1, CFP1, is a novel cyclin. CCNY acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway.

Loading...
||
New chat Able
正在加载,请稍候...