CCR10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCR10 Polyclonal antibody (22071-1-AP)

CCR10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22071-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

C C chemokine receptor type 10, C C CKR 10, C-C chemokine receptor type 10, CC CKR 10, C-C CKR-10

• 

  WB analysis of mouse brain using 22071-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22071-1-AP (CCR10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 22071-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22071-1-AP (CCR10 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 22071-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 22071-1-AP (CCR10 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 22071-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 22071-1-AP (CCR10 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCR10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22071-1-AP targets CCR10 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17212

  Product name: Recombinant human CCR10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-82 aa of BC099840

  Sequence: MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAARRAARSPTSAHLL

• Full Name: chemokine (C-C motif) receptor 10
• Calculated Molecular Weight: 362 aa, 38 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC099840
• Gene Symbol: CCR10
• Gene ID (NCBI): 2826
• RRID: AB_11182921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46092
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCR10 (also known as GPR2) is a G-protein coupled receptor for chemokines CCL27 (SCYA27) and CCL28 (SCYA28). CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation (PMID: 11821900). CCR10-CCL28 interactions are thought to contribute to the accumulation of IgA Ab-secreting cells (ASC) on mucosal surfaces.

Publications

What published studies show

The CCR10 Polyclonal antibody (Cat# 22071-1-AP) has 7 citations published in journals including Nature Communications, Advanced Science, Inflammation and Regeneration, Frontiers in Immunology, Journal of Ethnopharmacology, and Molecular Medicine Reports. Research fields span cardiac repair and angiogenesis, Alzheimer's disease, hair regeneration via Th22 cells, colorectal cancer prognosis, regulatory T cell characterization, and endometriosis.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; CCL28 contributes to angiogenesis and cardiac repair through CCR10(+) endothelial cells after myocardial infarction in male mice.; Authors - Kun Yang
mouse	WB	Adv Sci (Weinh); Bone Marrow-Derived GCA+ Immune Cells Drive Alzheimer's Disease Progression; Authors - Rui Zhou
mouse	IHC	Inflamm Regen; Th22 is the effector cell of thymosin β15-induced hair regeneration in mice; Authors - Nana Tao
human	WB	Front Immunol; Single-Cell Sequencing Reveals the Transcriptome and TCR Characteristics of pTregs and in vitro Expanded iTregs.; Authors - Zhenzhen Hui
human	IHC	Front Immunol; Chemokine family significance and prognostic value in colorectal cancer; Authors - Yi Ding
mouse	IHC,IF,FC	J Ethnopharmacol; Tetrahydroxy stilbene glucoside promotes hair regeneration by inducing Th22 cell differentiation.; Authors - Lingjie Zhang