Product Information
21018-1-PBS targets CCR9 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15268 Product name: Recombinant human CCR9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-369 aa of BC069678 Sequence: LSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 9 |
| Calculated Molecular Weight | 369 aa, 42 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC069678 |
| Gene Symbol | CCR9 |
| Gene ID (NCBI) | 10803 |
| RRID | AB_3742013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P51686 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CCR9 is a Gi-coupled chemokine receptor that directs T cell migration to the small intestine through interaction with CCL25, playing an essential role in thymocyte development and mucosal immune surveillance. Dysregulation of CCR9 signaling contributes to intestinal inflammatory diseases and hematologic malignancies, highlighting its importance in tissue-specific lymphocyte homing and immune regulation.
