CCSAP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CCSAP Polyclonal antibody, PBS Only (28644-1-PBS)

• 

  WB analysis using 28644-1-AP (same clone as 28644-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28644-1-AP (C1orf96 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28644-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28644-1-AP (same clone as 28644-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28644-1-AP (CCSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28644-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28644-1-AP (same clone as 28644-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28644-1-AP (CCSAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28644-1-PBS in a different storage buffer formulation.

CCSAP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28644-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

C1orf96, Centriole, cilia and spindle-associated protein, CSAP

---

Product Information

28644-1-PBS targets CCSAP in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23785

  Product name: Recombinant human C1orf96 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-270 aa of BC015419

  Sequence: MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHSVDVEKNRKMKASSSENPWMTEYMRCYSARA

• Full Name: chromosome 1 open reading frame 96
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC015419
• Gene Symbol: CCSAP/C1orf96
• Gene ID (NCBI): 126731
• RRID: AB_3086074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCSAP (Centriole, cilia and spindle-associated protein) colocalizes with polyglutamylated tubulin to centrioles, spindle microtubules, and cilia in human tissue culture cells (PMID: 22493317). Plays a role in microtubule (MT) stabilization and this stabilization involves the maintenance of NUMA1 at the spindle poles. It can be detected as around 30-36 kDa.