CoraLite® Plus 488-conjugated CD107a / LAMP1 Recombinant monoclonal antibody

• 

  IF Staining of C2C12 using CL488-86337-2

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using CoraLite® Plus 488 CD107a / LAMP1 antibody (CL488-86337-2, Clone: 250972C12 ) at dilution of 1:200.

CD107a / LAMP1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86337-2

Clone No.250972C12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

Synonyms

CD107a, Lamp1, Lamp 1

---

Tested Applications

• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86337-2 targets CD107a / LAMP1 in IF/ICC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3858

  Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 25-370 aa of NM_010684.3

  Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

• Full Name: lysosomal-associated membrane protein 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 90-120 kDa
• GenBank Accession Number: NM_010684.3
• Gene Symbol: CD107a
• Gene ID (NCBI): 16783
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11438
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697).