• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Mouse CD117/c-Kit Rabbit Recombinant Antibody

CD117/c-Kit FcZero-rAbTM Recombinant Antibody for FC
Cat No. APC-FcA98041
Clone No.240246C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD117, Kit, 240246C11, c KIT

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  APC
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse bone marrow cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.1 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98041 targets CD117/c-Kit in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0883

Product name: Recombinant Mouse CD117/c-kit protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 25-527 aa of NM_001122733.1

Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP

Predict reactive species
Full Name kit oncogene
Calculated Molecular Weight109 kDa
GenBank Accession NumberNM_001122733.1
Gene Symbol CD117
Gene ID (NCBI) 16590
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05532-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD117, also known as c-Kit and SCFR, is a transmembrane protein with tyrosine kinase activity encoded by the oncogene c-kit (PMID: 2448137). It is a member of the type III receptor tyrosine kinase family, which also includes CSF-1R, PDGFRβ, PDGFRα, and FLT3 (PMID: 29518044). CD117 is expressed on hematopoietic stem cells and progenitor cells, mast cells, and is also found in a wide range of non-haemopoietic cell types (including melanocytes, germ cells, astrocytes, renal tubules, breast glandular epithelial cells, sweat glands, and interstitial cells of Cajal) (PMID: 10582338; 23073628). CD117 plays an important role in early haemopoiesis. It is also involved in pigmentation, fertility, gut movement, and some aspects of the nervous system (PMID: 23073628).

Protocols

Product Specific Protocols
FC protocol for APC CD117/c-Kit antibody APC-FcA98041Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...