FcZero-rAb® Biotin Anti-Mouse CD126/IL-6R alpha Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse CD126/IL-6R alpha Rabbit Recombinant Antibody (Biotin-FcA98024)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD126/IL-6R alpha FcZero-rAb^® Recombinant Antibody for FC

Cat No. Biotin-FcA98024 Copied!

Clone No. 230371A7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD126, Il6ra, IL 6R, Il6r, IL-6R alpha

• 

  FC experiment of mouse splenocytes using Biotin-FcA98024

  1x10^6 mouse splenocytes were surface stained with APC Anti-Mouse CD4, and 0.25 ug Biotin Anti-Mouse CD126/IL-6R alpha Rabbit RecAb (Biotin-FcA98024, Clone: 230371A7) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using Biotin-FcA98024

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD126/IL-6R alpha Rabbit RecAb (Biotin-FcA98024, Clone: 230371A7) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD126/IL-6R alpha in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98024 targets CD126/IL-6R alpha in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0664

  Product name: Recombinant Mouse CD126/IL-6R alpha protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 20-357 aa of NM_010559.3

  Sequence: LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE

• Full Name: interleukin 6 receptor, alpha
• Calculated Molecular Weight: 50KD
• GenBank Accession Number: NM_010559.3
• Gene Symbol: Il6ra
• Gene ID (NCBI): 16194
• RRID: AB_3746870
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22272
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892).